Chicken Secondary Antibodies
CPC Scientific H-Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (trifluoroacetate salt) 0.5MG
Single chain peptide with 32 amino acids that stimulates bone formation by inhibiting osteoblasts, induces bone reabsorption and increases cAMP levels in osteoclasts.ONE-LETTER SEQUENCE: CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Cys1 and 7 bridge)MOLECULAR FORMULA: C145H240N42O46S2MOLECULAR WEIGHT:3371.9STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [100016-62-4], RESEARCH AREA: OsteoporosisREFERENCES: T. Kurihara et al., Peptide Chemistry, 1985, 173 (1986)
CPC Scientific (Suc-Ala-Ala-Pro-Phe)2-R110 0.5MG
Chymotrypsin.SEQUENCE: (Suc-Ala-Ala-Pro-Phe)2-R110ONE-LETTER SEQUENCE: (Suc-AAPF)2-R110MOLECULAR FORMULA: C68N74N10O17MOLECULAR WEIGHT: 1304.4STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: SYNONYMS: RESEARCH AREA: ApoptosisREFERENCES:Biol Chem Hoppe-Seyler 373, 433 (1992)Nature 361, 274 (1993)SKU(s): SUBS-007A, SUBS-007B
Abcam Chicken Anti-Rabbit IgG H&L.
Chicken Anti-Rabbit IgG H&L.
The product is subject to the following: Abcam Restricted Use Statement
Abcam Chicken Anti-Rat IgG H&L (HRP).
Chicken Anti-Rat IgG H&L (HRP).
The product is subject to the following: Abcam Restricted Use Statement
Sigma Aldrich Fine Chemicals Biosciences 6-Hexachloro-Fluorescein Phosphoramidite configured for PerkinElmer, configured for Polygen | 1360547-55-2 | MFCD01940924 | 0.1MMOL
6-Hexachloro-Fluorescein Phosphoramidite configured for PerkinElmer, configured for Polygen | Purity: >=97% (31P-NMR); >=97.0% (reversed phase HPLC); conforms (1H-NMR) | Mol Wt: 1050.61 | 1360547-55-2 | MFCD01940924 | 0.1MMOL
Sigma Aldrich Fine Chemicals Biosciences 6-Hexachloro-Fluorescein Phosphoramidite configured for ABI | 1360547-55-2 | MFCD01940924 | 0.1MMOL
6-Hexachloro-Fluorescein Phosphoramidite configured for ABI | Purity: >=97% (31P-NMR); >=97.0% (reversed phase HPLC); conforms (1H-NMR) | Mol Wt: 1050.61 | 1360547-55-2 | MFCD01940924 | 0.1MMOL
Jackson Immuno Research Labs R-Phycoerythrin AffiniPure F(ab')₂ Fragment Donkey Anti-Human IgM, Fc5μ fragment specific, 1ml
R-Phycoerythrin-AffiniPure F(ab')2 Fragment Donkey Anti-Human IgM, Fc5u Fragment Specific (min X Bov,Hrs Sr Prot)
Encor Biotechnology Inc CHICKEN POLYCLONAL AB
Chicken Polyclonal to Peripherin, PRPH.500UL OF IGy PREP
Chicken anti-Mouse IgG Fc Secondary Antibody, HRP, Invitrogen™
Chicken Polyclonal Secondary Antibody
Chicken anti-Mouse IgG Fc Secondary Antibody, FITC, Invitrogen™
Chicken Polyclonal Secondary Antibody
Chicken anti-Mouse IgG Fc Secondary Antibody, Biotin, Invitrogen™
Chicken Polyclonal Secondary Antibody