Chicken Secondary Antibodies
CPC Scientific H-Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (trifluoroacetate salt) 0.5MG
Single chain peptide with 32 amino acids that stimulates bone formation by inhibiting osteoblasts, induces bone reabsorption and increases cAMP levels in osteoclasts.ONE-LETTER SEQUENCE: CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Cys1 and 7 bridge)MOLECULAR FORMULA: C145H240N42O46S2MOLECULAR WEIGHT:3371.9STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [100016-62-4], RESEARCH AREA: OsteoporosisREFERENCES: T. Kurihara et al., Peptide Chemistry, 1985, 173 (1986)
Genscript Corporation EGF Chicken
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6
Biotium Secondary Antibody Rabbit IgG Chicken CF583R 1/EA
This product is prepared by labeling an affinity-purified chicken anti-rabbit IgG (H plus L) with CF and reg 583R dye CF and reg dyes are Biotiums line of next-generation fluorescent dyes with advantages in brightness photostability and conjugate specificity compared to other fluorescent dyes
American Research Products Inc Chicken anti streptolysin O A
Chicken anti-streptolysin O (ASO) antibody (IgG) ELISA Kit from CUSABIO Detection Range Sensitivity Sample serum plasma Method Indirect
Abcam Chicken Anti-Rabbit IgG H&L (HRP).
Chicken Anti-Rabbit IgG H&L (HRP).
The product is subject to the following: Abcam Restricted Use Statement
Immunoreagents Inc CHICKEN A-RAT IGG DYLIGHT 550
Secondary Antibody; Chicken anti-rat IgG (H&L) - Affinity Pure, min x w/Hu or Rb IgG or Serum Proteins, DyLight 550 Conjugate, Host: Chicken, Format: Lyo, Label: DyL550, Applications: WB, ELISA, IHC/ICC, IF, IP, FC, FACS
Abcam Chicken Anti-Rat IgG H&L (HRP).
Chicken Anti-Rat IgG H&L (HRP).
The product is subject to the following: Abcam Restricted Use Statement
American Research Products Inc AMERICAN RESEARCH PRODUCTS INC
5000606208 MOUSE ANTI-CHICKEN OVOMUCOI...
Immunoreagents Inc CHICKEN A-MOUSE IGG HRP
Secondary Antibody; Chicken anti-mouse IgG (H&L) - Affinity Pure, HRP Conjugate, Host: Chicken, Format: Lyo, Label: HRP, Applications: WB, ELISA, IHC/ICC
